Protein Info for MIT1002_00961 in Alteromonas macleodii MIT1002

Annotation: Cytochrome c-type biogenesis protein CcmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 94 to 120 (27 residues), see Phobius details amino acids 126 to 152 (27 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details TIGR01190: heme exporter protein CcmB" amino acids 7 to 217 (211 residues), 256.7 bits, see alignment E=7.9e-81 PF03379: CcmB" amino acids 7 to 218 (212 residues), 258.1 bits, see alignment E=2.9e-81

Best Hits

Swiss-Prot: 58% identical to CCMB_HAEIN: Heme exporter protein B (ccmB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02194, heme exporter protein B (inferred from 97% identity to amc:MADE_03073)

MetaCyc: 56% identical to cytochrome c maturation protein B (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>MIT1002_00961 Cytochrome c-type biogenesis protein CcmB (Alteromonas macleodii MIT1002)
MSLYQGIFKRDMQVAFKQKAELVQPLMFLLMVVTLFPLGVSPSPDTLQRIGPGVIWIAAI
LSSLLAMERLFRDDFQDGSLEQYMLSGMPLPAVSAVKVAAHWLVSFVPLLLLSPLLAMFL
NLTVDMYIALVLTLLLGTPLLSLIGAIAVGLTVGLQKGGVLLALLLIPVFIPLLIFATSA
VDSAALQLPYYAQLAIIAAMLLLAAALAPFAIAYSLKVSQN