Protein Info for MIT1002_00960 in Alteromonas macleodii MIT1002

Annotation: Cytochrome c biogenesis ATP-binding export protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 2 to 194 (193 residues), 230 bits, see alignment E=1.1e-72 PF00005: ABC_tran" amino acids 18 to 158 (141 residues), 97.4 bits, see alignment E=5.7e-32

Best Hits

Swiss-Prot: 49% identical to CCMA_VIBCH: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 90% identity to amc:MADE_03074)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>MIT1002_00960 Cytochrome c biogenesis ATP-binding export protein CcmA (Alteromonas macleodii MIT1002)
MLEARELTCSKRDRTLFEGLSLVVEPGELLYLRGPNGAGKTSLLRILTGLSSPDSGAVLY
NGMDISEDKTGYYRDLFYLGHKSGTNGSLSALDNLSFWLAQHNVSVPVNTLFDVLEKVGL
VGLEDVPVRYLSAGQQRRVALSRLWLKPAKVWILDEPFTALDVKGVHMLEKSMKEHVGRG
GLIITTSHQHLSETAGEHRVFDLEYRF