Protein Info for MIT1002_00951 in Alteromonas macleodii MIT1002

Annotation: Enolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR01060: phosphopyruvate hydratase" amino acids 4 to 427 (424 residues), 686.2 bits, see alignment E=7.3e-211 PF03952: Enolase_N" amino acids 4 to 134 (131 residues), 199.7 bits, see alignment E=1.9e-63 PF00113: Enolase_C" amino acids 144 to 428 (285 residues), 469.2 bits, see alignment E=5.5e-145

Best Hits

Swiss-Prot: 99% identical to ENO_ALTMD: Enolase (eno) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 99% identity to amc:MADE_03083)

MetaCyc: 81% identical to enolase (Escherichia coli K-12 substr. MG1655)
Phosphopyruvate hydratase. [EC: 4.2.1.11]

Predicted SEED Role

"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>MIT1002_00951 Enolase (Alteromonas macleodii MIT1002)
MAKISRIIGREILDSRGNPTVEADVYLESGVMGRAAAPSGASTGSREALELRDGDKSRYL
GKGVTKAVAAVNDTIAPALIGKDALAQADIDGIMIDLDGTENKETLGANAILAVSLAVAK
AAAAEKGVALYEHIADLNGTSGQYSMPVPMMNIINGGEHADNNVDIQEFMVQPVGAKSFK
EALRMGAEIFHALKKVLSAKGLNTAVGDEGGFAPNLSSNAEALAVIVEAVENAGYKMNED
ITLALDCAASEFYKEGKYVLSGEDKSFDSEAFGDYLADLSSQYPIVSIEDGLDESDWDGW
ASLTKKIGDKVQLVGDDLFVTNTKILKRGIDNGIGNSILIKFNQIGSLTETLNAIKMAKD
AGFTAVISHRSGETEDATIADLAVGTAAGQIKTGSLCRSDRVAKYNQLLRIEEALGDAAI
YKGRSEIKGQ