Protein Info for MIT1002_00921 in Alteromonas macleodii MIT1002

Annotation: Inner membrane transport permease YhhJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 25 to 362 (338 residues), 122.6 bits, see alignment E=4.2e-39 PF12679: ABC2_membrane_2" amino acids 81 to 366 (286 residues), 68.5 bits, see alignment E=1.2e-22 PF01061: ABC2_membrane" amino acids 178 to 334 (157 residues), 93.6 bits, see alignment E=2.7e-30 PF12730: ABC2_membrane_4" amino acids 180 to 290 (111 residues), 27.5 bits, see alignment E=5.7e-10

Best Hits

Swiss-Prot: 57% identical to YHHJ_ECOLI: Inner membrane transport permease YhhJ (yhhJ) from Escherichia coli (strain K12)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 95% identity to amc:MADE_00132)

Predicted SEED Role

"Putative transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>MIT1002_00921 Inner membrane transport permease YhhJ (Alteromonas macleodii MIT1002)
MDIKNVGQLGVKELWSLWRDPAMLILVVYVFTVNIYTAATAVPESLHNAPIAFVDHDNSQ
MSKRIIDAFYPPYFLTPDLIESNEADTYLDTGKYAFVVTIPPEFEKDIMAGLQPDVQVNV
DATRISQAFTGNGYITEIITSEVNTYLQGYKSDIDYPVELIMRVRFNPALEGFWFGSVME
LINAVTMIAIILSGAALIREKERGTIEHLLAMPVSDSEIMLSKILASGVVVWVTTLFSVY
FIIQWVLSVPINGEIWLFMVAVALQLFAVSSMGIFMATIARSMPQFGLLLILVLLPLQLL
SGGVTPRESMPGFIQSAMLLMPNTHFVEASQGVLYRGAGISVVYPQLLALLAIGCAFYLI
ALKRFKSTVGSMT