Protein Info for MIT1002_00909 in Alteromonas macleodii MIT1002

Annotation: Glucosamine kinase GspK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01869: BcrAD_BadFG
  • amino acids 7 to 257 (251 residues), 65.7 bits, E=2.5e-22

Best Hits

KEGG orthology group: None (inferred from 36% identity to psm:PSM_B0132)

Predicted SEED Role

"N-acetylglucosamine kinase of eukaryotic type (EC 2.7.1.59)" in subsystem Chitin and N-acetylglucosamine utilization (EC 2.7.1.59)

MetaCyc Pathways

• N-acetylglucosamine degradation II (2/3 steps found)
• chitin derivatives degradation (2/8 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.59

Protein Sequence (291 amino acids)

>MIT1002_00909 Glucosamine kinase GspK (Alteromonas macleodii MIT1002)
MSYKYVVGIDGGGTRCRALLQDIDGNTLGEGAAGPANIMTNPEQAMGSVIDATLDAIESA
ALPITCEEVLLAAGLAGANIPQAKQSFLELDNPFADTVVISDLHAACLGAHDNQSGALII
CGTGSAATHYDKGVFTDKGGYGLQVGDDASGAWLGLSAIKHVLLSYDGVEPVSELKKRIC
EHLNLASPQQLVTLVANYNAADFGDIAPVVIQAYRDQCAAATSLIRKGAIYLNQLGEALI
NQASTLPLCLVGGLADIYTPLLSPSISSNLTAPLKSAEYGAISFAKRVKSE