Protein Info for MIT1002_00908 in Alteromonas macleodii MIT1002

Annotation: Transposase IS116/IS110/IS902 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF01548: DEDD_Tnp_IS110" amino acids 6 to 146 (141 residues), 73.1 bits, see alignment E=2.4e-24 PF02371: Transposase_20" amino acids 211 to 288 (78 residues), 73.5 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 45% identical to TRA1_COXBU: Transposase for insertion sequence element IS1111A (CBU_0006) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: None (inferred from 58% identity to ppr:PBPRB0627)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>MIT1002_00908 Transposase IS116/IS110/IS902 family protein (Alteromonas macleodii MIT1002)
MSKVTIGLDIAKSVFHLVFMNQSGRVLRKKKLRRHQMLSYFSQLEPCIVVMEACGSCHYW
CRELTKAGHEVKAIAPQYVVAYRKGNKHDYNDAEAIAEASQREGMRFVPFKSQDQQDIQL
MHRIRERMIAQQTALSNQIRGLLSEYGIVYARGVATLVKELPLTLEEADNGLSMLARRQF
QGLLNDLRELREHIKEMDKELKAFSQSQPVCERLMSMTGIGPLIATALYAGIGQGQAFNS
GRHLAAWLGVVPKQHTTGDNPRLLGISKRGNTYLRTQIINGARAALRHIGDKTDKVSEWC
RACLARMSFNKACVALANKMVRMAWAMLHYQQDYQPGLINKAAA