Protein Info for MIT1002_00895 in Alteromonas macleodii MIT1002

Annotation: Chemotaxis regulator BdlA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 TIGR00229: PAS domain S-box protein" amino acids 151 to 260 (110 residues), 36.8 bits, see alignment E=1.9e-13 PF08448: PAS_4" amino acids 153 to 254 (102 residues), 34.4 bits, see alignment E=4.6e-12 PF13426: PAS_9" amino acids 160 to 254 (95 residues), 33.9 bits, see alignment E=6.4e-12 PF08447: PAS_3" amino acids 164 to 248 (85 residues), 39.6 bits, see alignment E=1.1e-13 PF00015: MCPsignal" amino acids 299 to 430 (132 residues), 127.6 bits, see alignment E=9.4e-41

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 73% identity to alt:ambt_14260)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>MIT1002_00895 Chemotaxis regulator BdlA (Alteromonas macleodii MIT1002)
MFVSSSRYNNDISALRDESQGLLGTLDAFKSTMAYAIYSTDGQCTFASPVLLSILDYPNS
TATSFSHAAMRVEGVEPESQYKSFWQHLVNGGSFSDTVARKSALGETKWLKASYVAVNKH
GVTEIHAIYHDITEHENAYFAGKAVTDALNKSMAVIEFHPDGTIITANENFTATVKYSLA
DIQGKHHRMFCRDKFYQENPNFWDNLARGNFSSGQFERVDAHGNALWLEATYNPVFDASG
RVVKVIKFASNITDAINEKNAIAQAAELAVSTAEETSQIAHEGASSLQRSVEIFNTAMLE
VEQTNQLMHELSEQSLKIETIVTTISGIAEQTNLLALNAAIEAARAGDQGRGFAVVADEV
RQLAQRTSDSTVEIESVVAENRKLADKSTKKMAGVKDSVDQNSQQIAQVQSIIDEIQKGA
LNVSETVSGILR