Protein Info for MIT1002_00886 in Alteromonas macleodii MIT1002

Annotation: hemolysin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 92 to 140 (49 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details PF03006: HlyIII" amino acids 23 to 216 (194 residues), 126.2 bits, see alignment E=8.3e-41 TIGR01065: channel protein, hemolysin III family" amino acids 26 to 222 (197 residues), 207.5 bits, see alignment E=7.9e-66

Best Hits

Swiss-Prot: 51% identical to YQFA_ECOL6: UPF0073 inner membrane protein YqfA (yqfA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11068, hemolysin III (inferred from 94% identity to amc:MADE_03143)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>MIT1002_00886 hemolysin (Alteromonas macleodii MIT1002)
MIQEQIQTQAVPQSKSIPAKAYSVLEEWLNSISHGVGFIAAIVGLVFMLYRAEDTLALTT
AAIYGSTLILVFLSSTLYHAISHQKAKGWLKLFDHSAIYLLIAGTYTPLLLVSIGGVLGI
TMTAIIWSLAIGGVAFKLVAQHRFPKVSVMTYLLMGWIALGLIYPLYVALPGAGLWLLVA
GGLCFSVGVCFYVAKKVKYTHAIWHMFVIGGCSCHYFSIYFFVV