Protein Info for MIT1002_00876 in Alteromonas macleodii MIT1002

Annotation: Phosphate import ATP-binding protein PstB 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 22 to 268 (247 residues), 388.4 bits, see alignment E=6.2e-121 PF00005: ABC_tran" amino acids 37 to 193 (157 residues), 116.5 bits, see alignment E=1.4e-37 PF13304: AAA_21" amino acids 143 to 223 (81 residues), 36.7 bits, see alignment E=5e-13

Best Hits

Swiss-Prot: 67% identical to PSTB1_VIBPA: Phosphate import ATP-binding protein PstB 1 (pstB1) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 96% identity to amc:MADE_03149)

MetaCyc: 54% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>MIT1002_00876 Phosphate import ATP-binding protein PstB 3 (Alteromonas macleodii MIT1002)
MLKLFEHNTLNVNDIDEEQTAVEVKNLNLWFGNKHVLNDISMRIPKNKITALIGQSGCGK
STLISCFNRLNDLYDGCKYDGEIIIDGQNINSRKVNVSRLRTNVGMVFQRPNPFPMSIYE
NVCYGLKLQGVKIRRHLDDAVESALKQAALWDEVKDRLFESAHVLSGGQQQRLVIARALA
LKPDILLLDEPTSALDPLTTLFIEELMDALKKQCTIIIVTHNMQQAARVSDYTAFFHQGR
LIEYADSDTLFTMPEKKQTEDYITGRYG