Protein Info for MIT1002_00875 in Alteromonas macleodii MIT1002

Annotation: Phosphate transport system permease protein PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 19 to 42 (24 residues), see Phobius details amino acids 270 to 298 (29 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 410 to 430 (21 residues), see Phobius details amino acids 486 to 508 (23 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 255 to 513 (259 residues), 244.2 bits, see alignment E=7.2e-77 PF00528: BPD_transp_1" amino acids 289 to 514 (226 residues), 52 bits, see alignment E=3.8e-18

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 88% identity to amc:MADE_03150)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>MIT1002_00875 Phosphate transport system permease protein PstA (Alteromonas macleodii MIT1002)
MVNRTTFGLSAVQRQSLVISLTAFFTSLLLIALVSILILISFRGTAYFWPEPIYTVTGTH
QDGTRFSVLANLFDESTNEDVTLKFSDAQHPYGFQVQLSREEIETSLLANQSAEIKLLDG
RRVLAIPEYIVVPSKPPQPLGNIDIVLEEVAQISAQIEDLNTQHLAPIHEALSQFDKRNV
VADAPARERLVASFDEYQKRVEALEATRAEYTLLVSFADETPFVIPISSIQDVDFVSRLS
TWEKWQVAFSEIGVFLTDSPKQANTSGGVFPALFGTVLMVFLMTIIVTPFGVLAAIYLSE
YAPNTALTTIIRVSVSNMAGVPSIVYGVFGLGFFVYTLGGSIDELLFSDTLPAPTMGSPG
VFWAALTMAILTLPVVIVATEEGLRRVPEGLKAGSYALGATKIETIVRTVLPIASPGIMT
GVILAIARAAGEVAPLMLVGAVKFAPTLPIDGEFPYLHLDRQFMHLGVLIYDGAFHSQTD
GKSASMMFAACLLLLVVVFVLNILAVVLRARLRKRYLKG