Protein Info for MIT1002_00866 in Alteromonas macleodii MIT1002

Annotation: Toluene efflux pump periplasmic linker protein TtgA precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 46 to 343 (298 residues), 209.4 bits, see alignment E=3.3e-66 PF25917: BSH_RND" amino acids 59 to 178 (120 residues), 27.7 bits, see alignment E=5.8e-10 PF25876: HH_MFP_RND" amino acids 92 to 153 (62 residues), 28 bits, see alignment E=6.5e-10 PF25944: Beta-barrel_RND" amino acids 188 to 270 (83 residues), 55.5 bits, see alignment E=1.9e-18 PF25954: Beta-barrel_RND_2" amino acids 188 to 268 (81 residues), 23.6 bits, see alignment E=1.5e-08 PF25967: RND-MFP_C" amino acids 274 to 335 (62 residues), 32.5 bits, see alignment E=2.1e-11

Best Hits

KEGG orthology group: K03585, membrane fusion protein (inferred from 59% identity to mfa:Mfla_0374)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>MIT1002_00866 Toluene efflux pump periplasmic linker protein TtgA precursor (Alteromonas macleodii MIT1002)
MSKKALLAVSIVSALLGGCGHEEHAAHHEKLQFNVTHPILQDTTLVKEYVSQIRAIQHIE
VRAMEKGYLQSTFVDEGQTVERGQPMFKIMPNVYEAELHRAEAEAKAVEMEYKNTKSLVE
QNIVSPNELAVIEAQLQKAQAEVELAKTHLAFTDIKAPFTGKMDRLEARTGSLLDEGELL
TTLSDISTMWVYFNVPESEYLKYAQNSASNDQTSVRLKLADGSIYAHQGVIDAIEADFDN
HTGTIEMRASFPNPDQLLRHGQTGNVMVDIAYPDALVIPQKATFEILDQSFVYVLDSENK
LATRHINIAAELPNIYLVSDGLAPDDTILIEGLRRVSNGDEIEPELISASDTLAELSLHA
E