Protein Info for MIT1002_00849 in Alteromonas macleodii MIT1002

Annotation: bifunctional preprotein translocase subunit SecD/SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 855 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 360 to 379 (20 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details amino acids 455 to 477 (23 residues), see Phobius details amino acids 483 to 506 (24 residues), see Phobius details amino acids 552 to 569 (18 residues), see Phobius details amino acids 671 to 691 (21 residues), see Phobius details amino acids 698 to 719 (22 residues), see Phobius details amino acids 725 to 745 (21 residues), see Phobius details amino acids 777 to 796 (20 residues), see Phobius details amino acids 802 to 828 (27 residues), see Phobius details PF07549: Sec_GG" amino acids 41 to 63 (23 residues), 20.5 bits, see alignment (E = 8.3e-08) amino acids 567 to 588 (22 residues), 27.2 bits, see alignment (E = 6.5e-10) TIGR01129: protein-export membrane protein SecD" amino acids 46 to 507 (462 residues), 436 bits, see alignment E=2.3e-134 PF21760: SecD_1st" amino acids 162 to 217 (56 residues), 73.5 bits, see alignment 2.2e-24 PF22599: SecDF_P1_head" amino acids 225 to 338 (114 residues), 127.5 bits, see alignment E=6.6e-41 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 270 to 500 (231 residues), 250.2 bits, see alignment E=2.9e-78 PF02355: SecD_SecF_C" amino acids 341 to 507 (167 residues), 64.9 bits, see alignment E=2e-21 amino acids 646 to 829 (184 residues), 183.1 bits, see alignment E=1.2e-57 PF00873: ACR_tran" amino acids 355 to 570 (216 residues), 36.4 bits, see alignment E=4.3e-13 PF03176: MMPL" amino acids 385 to 513 (129 residues), 32.9 bits, see alignment E=1e-11 TIGR00966: protein-export membrane protein SecF" amino acids 572 to 820 (249 residues), 217.5 bits, see alignment E=3.6e-68

Best Hits

KEGG orthology group: K12257, SecD/SecF fusion protein (inferred from 94% identity to amc:MADE_03171)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1) / Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (855 amino acids)

>MIT1002_00849 bifunctional preprotein translocase subunit SecD/SecF (Alteromonas macleodii MIT1002)
MVRFSFRGFVYVLIVMLGLLSAAPNILPQSIKQQLPTWYTTSTLSLGLDLQGGSHLLLAA
DTNALFEKQLNSFSSDLLSELRSQNVRYTKTSHSLTHKDSRSGSVVFTLRSADDARKVKD
TAYQISAQPNGSSALDVEIKQSTVTLTLNELYTEQLVKDTLSRSVEVVRKRLNETGLTEP
SVTLQGKDAILVQMPGMSDPTQVKKLLGTTAQMTFHWAANSQSEQVMNKQDAAGNTYRLE
QKVALEGEHITDAAGVLSSENGQPVVTFRLDSAGAKQFATMTRDNIGRVLAIVLDDKVVT
APVINSVIPGGRGEITGNFTLPEAGNTALMLRTGALPVPLTIIEERTVGPDLGSDAIQTG
VESGVAGALLVLAFMVAIYGRWGAIASFALCINMALVFGALTLFGATLTLPGIAGLILTM
GMAVDANILINERIREESKKGRPAASAIEVGFDKAFATIVDSNFTTLIAVSLLFMFGSGP
IKGFAITIALGLVSSVFTAVALTKMLMLRVVKSKHKNTQDRAQQRVPLRFSSPLLRLSDK
LSGINFLAKRKIALAVSVVLTVLSIGLFAKPGLHYGVDFTGGTMIELTAPTLTTDELRNV
IESNGFDQIAIQEYGSEHHYLLRAPVLDSSGELENSNAKQTDALKRAISQADSEVSFDKI
DMVGPKVSGGFAELSILALLIAGGGMLLYLWARFEAHFASAALLTVILDLTKTIGFFALT
GIEFNLTAVAALLALIGYSINDKVVVLDRIRELLRLDPNKPSADTINEAVNSTLSRTVFT
SVTTLLALLPMAIFGGDAVESFAVPMVFAVVIGTSSTLFITSTLLYLLGSRREKQGKAQL
KPTAEEIKASLSHIP