Protein Info for MIT1002_00830 in Alteromonas macleodii MIT1002

Annotation: Lipopolysaccharide export system protein LptC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details TIGR04409: LPS export ABC transporter periplasmic protein LptC" amino acids 15 to 188 (174 residues), 156.5 bits, see alignment E=2.5e-50 PF06835: LptC" amino acids 16 to 188 (173 residues), 139.6 bits, see alignment E=4.1e-45

Best Hits

KEGG orthology group: K11719, lipopolysaccharide export system protein LptC (inferred from 91% identity to amc:MADE_03190)

Predicted SEED Role

"Uncharacterized protein YrbK clustered with lipopolysaccharide transporters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>MIT1002_00830 Lipopolysaccharide export system protein LptC (Alteromonas macleodii MIT1002)
MSLFGFNRLGLSISALFILAMLMYIPTWMEEQPETQGNRENDALKPAYKAKNLTTTLYNQ
DGELNHKVFAESMEHYDQLGFVLFQQPKYTLYTENASSPWVVTADEGTLYNNELIQLENQ
VNIENQTGDDFVRSISTEYIQINLETKQMTSDQPVEILGTQYVILSNGFNANLRTQEYEL
LDHVQTTYSPSN