Protein Info for MIT1002_00822 in Alteromonas macleodii MIT1002

Annotation: Magnesium transporter MgtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 290 to 309 (20 residues), see Phobius details amino acids 316 to 342 (27 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details amino acids 424 to 450 (27 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 17 to 451 (435 residues), 307.4 bits, see alignment E=7.9e-96 PF03448: MgtE_N" amino acids 36 to 137 (102 residues), 88.9 bits, see alignment E=4.6e-29 PF00571: CBS" amino acids 142 to 197 (56 residues), 21.4 bits, see alignment 4e-08 amino acids 203 to 258 (56 residues), 36 bits, see alignment 1.1e-12 PF01769: MgtE" amino acids 325 to 445 (121 residues), 112.4 bits, see alignment E=2.6e-36

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 97% identity to amc:MADE_03198)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>MIT1002_00822 Magnesium transporter MgtE (Alteromonas macleodii MIT1002)
MAEALVSKYVQTQLRALNAALTNGQFVSVRKLLLELPPSDVAHILESSPSRTRDELWELI
DGDFHGDILEELSDDVRNGIITKMLPANVVDALEEMDTDDLAETLSSLPEPVLADILDSM
DAQDRVRAEQALSYGEETAGFIMNTDTITLRPDVTIDVVLRYIRLKGELPENTDTFYVVN
RTDNLVGIVPVTRLLTADTDDKVSDVMDEESEAIPVNMPDDEVASLFERYNWLSAPVVDE
NHRLVGRITIDDVVDIIREDAEHSMMSMAGLDDDEDTFAPVMQSTKRRSVWLAVNLVTAL
MAAMVSDLFEATLSQLAVLAILNTIVPSMGGVAGNQTLTLVIRGMALGHVNASNSRWLIS
KEISIGFLNGAIWAVLIASVIALWKQDYMLGVIIAFAMMVNMIAAALAGATLPMIMKRLK
IDPALAGSVILTTITDVVGIFAFLGTATLFLI