Protein Info for MIT1002_00816 in Alteromonas macleodii MIT1002

Annotation: Cytochrome c1 precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02167: Cytochrom_C1
  • amino acids 30 to 242 (213 residues), 72.7 bits, E=3.7e-24

Best Hits

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 92% identity to alt:ambt_14670)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Protein Sequence (244 amino acids)

>MIT1002_00816 Cytochrome c1 precursor (Alteromonas macleodii MIT1002)
MKKMMCFLAFFLPGVAFAAGGNVHLDEAPIDLTDKASLQRGAQLFMNYCLGCHSMKYQRY
QRSFQDLGIPDELGQEYLQFTGDKVSDYITRAMPEEAAAGWFGAAPPDLTLVARVRGEDW
IYTYLRSFYVDESRPFGVNNTVFPEVGMPHVLQPLQGTPTRTYEEQMVDGEMVKRYVGIK
SDGTGAMSPDEYDQAVADIVNFLEYTGEPAKLESHKIGKWVLIFIAVLFVFVYLLKKEYW
REVH