Protein Info for MIT1002_00815 in Alteromonas macleodii MIT1002

Annotation: Cytochrome b/c1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 301 to 318 (18 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details PF00033: Cytochrome_B" amino acids 24 to 211 (188 residues), 218.7 bits, see alignment E=9.7e-69 PF13631: Cytochrom_B_N_2" amino acids 93 to 282 (190 residues), 135.8 bits, see alignment E=2.2e-43 PF00032: Cytochrom_B_C" amino acids 296 to 397 (102 residues), 130.7 bits, see alignment E=3.3e-42

Best Hits

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 100% identity to amc:MADE_03380)

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>MIT1002_00815 Cytochrome b/c1 (Alteromonas macleodii MIT1002)
MNAFLGWIEERIPMMRVANMHALQYPAPKNMNFWYVFGFLATIVLVNQIVTGIWLTMNFV
PSSEGAFASVEYIMREIDYGWIIRYMHSTGASAFFIVVYLHMFRGMIYGSYQKPRELLWV
FGMFIYLALMAEAFMGYVLPWGQMSYWGAQVIVSLFGAIPVVGPDLVIWLQGDYVISGAT
LNRFFALHVIALPLVIVILVFLHIIALHEVGSNNPDGIAIKHKKGSLPESEKTKYEIHEY
YTSKYDIADDVLPFFPHIVLKDLVAFCVFLALFTYVLFFAPEMGGKFLEHPNFEIANPLK
TPAHIFPVWYFTPFYAILKAVPDKLFGVLAMFGAIAALFALPWVDRGRVKSWRYRCGLHK
VNLIVFAIVFVFLGYLGGTPQENWKIIASQIATVMYFGFFIALFLYSKNENTKPVPERIS
K