Protein Info for MIT1002_00814 in Alteromonas macleodii MIT1002

Annotation: Ubiquinol-cytochrome c reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details PF10399: UCR_Fe-S_N" amino acids 15 to 53 (39 residues), 54.6 bits, see alignment 5.7e-19 TIGR01416: ubiquinol-cytochrome c reductase, iron-sulfur subunit" amino acids 22 to 204 (183 residues), 237.4 bits, see alignment E=5e-75 PF00355: Rieske" amino acids 124 to 186 (63 residues), 29.8 bits, see alignment E=4.5e-11

Best Hits

KEGG orthology group: K00411, ubiquinol-cytochrome c reductase iron-sulfur subunit [EC: 1.10.2.2] (inferred from 98% identity to alt:ambt_14680)

Predicted SEED Role

"Ubiquinol-cytochrome C reductase iron-sulfur subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>MIT1002_00814 Ubiquinol-cytochrome c reductase iron-sulfur subunit (Alteromonas macleodii MIT1002)
MSNVSVDATESAHNENQPENNTRRRFLTVATSVVGGVGVVGAAVPFIASWNPSAKAKAAG
ADVEVDISGIEPGQLVRVMWRSKPVWIVRRTPEILEELGTHEDKLKDPNSEAEQQPAFAQ
NRFRSMKEEYLILVGICTHLGCSPQHLKDGAFEEVVEGVPDGFFCPCHGSKFDMAGRVFQ
NVPAPLNLVVPPYQFVDDNNIIIGSEAEAV