Protein Info for MIT1002_00799 in Alteromonas macleodii MIT1002

Annotation: 3-oxoacyl-[acyl-carrier-protein] reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00106: adh_short" amino acids 8 to 190 (183 residues), 140.2 bits, see alignment E=1.9e-44 PF08659: KR" amino acids 10 to 164 (155 residues), 49.1 bits, see alignment E=2e-16 PF02719: Polysacc_synt_2" amino acids 10 to 110 (101 residues), 26 bits, see alignment E=1.6e-09 PF01370: Epimerase" amino acids 10 to 166 (157 residues), 28.5 bits, see alignment E=3e-10 PF13561: adh_short_C2" amino acids 14 to 191 (178 residues), 84.6 bits, see alignment E=2.4e-27

Best Hits

KEGG orthology group: None (inferred from 94% identity to amc:MADE_03395)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>MIT1002_00799 3-oxoacyl-[acyl-carrier-protein] reductase FabG (Alteromonas macleodii MIT1002)
MNIQWRNQVVLLTGATGGIGQAIAKALDEKGAHIILTSRSKAKLEQLQQNLTLHHTAIVA
DITSDEGRDRVVSACQRRPLSILVNNAGITYVGEFDGTPIESIVSTNMLAPMLLTQRLLP
LLERRPSAHVVNVGSAFGSIGFAAHGTYCATKFALKGWTEAMHREFSDSKIKFHYLAPRA
TRTDINDDRANALNEALGNQTDEPDAVAQAFIKQLENNLPRVALGHAERFFAKLNALVPS
VVDNALAKKLPTIKRYAFQKTRSQDKQTSAQNETRLGNKLV