Protein Info for MIT1002_00793 in Alteromonas macleodii MIT1002

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 57 to 470 (414 residues), 302.6 bits, E=2.2e-94
• PF05958: tRNA_U5-meth_tr
  • amino acids 131 to 477 (347 residues), 74.4 bits, E=9.2e-25
• PF13847: Methyltransf_31
  • amino acids 331 to 414 (84 residues), 28.3 bits, E=1.4e-10

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (480 amino acids)

>MIT1002_00793 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Alteromonas macleodii MIT1002)
MANLFKQSRSKLTERGASKKGNARANAQVAGLRFGKSKIAADTSESQKPNTVTIEDLDWM
GNGVVRGNPMVFVEGALVGETCDIEVLSSKKKVINAKATNIHSPSDERQAPFCPVFDACG
GCQLQHIKPDAALVQRDRALKVMMERHLAMKPDVWQAPLAGPRPQYRRKARLAIDARNPN
QIKLGFREANSNNVINVETCPILVDPLSKLIGPLRDALTGFESARHIGHISLIAGDNTSH
LVIKHTKALEAELIDAVSELVNTSSSVNGYEIELKLENKQGQIRSVGRGTDMVMNTVSGC
SISPSANDFVQINKAVNEKMINQAIGWLNPKPNERIADWFSGLGNFTLPIAKLGAEVQAV
EGVAEMVRRAKDNAQQQGIENVEWLHLDLADKTNVEASLQQDFDKVLLDPSREGALTVCH
ALVKALPKTIVYVSCNPSTFSRDAKVLIDGGYEMEKAGVAEMFPFTHHMEMMALFTRKQQ