Protein Info for MIT1002_00788 in Alteromonas macleodii MIT1002

Annotation: Single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 20 to 569 (550 residues), 517.1 bits, see alignment E=2.2e-159 PF01368: DHH" amino acids 70 to 204 (135 residues), 88.3 bits, see alignment E=7.8e-29 PF02272: DHHA1" amino acids 354 to 449 (96 residues), 76.1 bits, see alignment E=4.1e-25 PF17768: RecJ_OB" amino acids 466 to 568 (103 residues), 85.3 bits, see alignment E=4.4e-28

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 93% identity to amc:MADE_03407)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>MIT1002_00788 Single-stranded-DNA-specific exonuclease RecJ (Alteromonas macleodii MIT1002)
MILPIVRREVTGASLSSDLHPVIDRIYRGRNIANLDDLENGLKGLTHFNVLKGMPQAAQI
LANAVVQNKRIIIVGDFDADGATSTSVCILALRAMGYHNVDFLVPNRFDFGYGLSVPIVD
EAAKQGAEVIVTVDNGISCIDGVTHAKSLGMQVVVTDHHLPGDVLPPADAIVNPNQPGCE
FPSKNLAGVGVAFYIMLALKAELQQQGHFERAGLAPPNLASLLDIVAVGTVADVVVLDKN
NRILVHQGLQRIRAGKCRPGIKALVEVANRDCAHLTSTDLGFVVGPRLNAAGRLDDMSQG
IACLLEDETIQARMIAAELDALNKERREIETGMKAQAEIVLEQMALDEGDMPSALVVYRE
DFHQGVIGIVAGRLKEKYLKPVIAFAHQDDEIIKGSARSIPGVHIRDVLDEVNTRYPGVI
EKFGGHAMAAGLSLPVAKLQEFEQAFVDIARAHMAKLDGNHALLSDGDLSSKELCLPFAH
LLRQAGPFGQGFESPLFDGEFALLDQRLVGQKHLKMVLKSDGANEVDAIAFNVDLKSWPN
AMVKRVHIAYRLDINVFRGQETVQLIVEQIEAR