Protein Info for MIT1002_00786 in Alteromonas macleodii MIT1002

Annotation: Tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF02899: Phage_int_SAM_1" amino acids 19 to 101 (83 residues), 74.3 bits, see alignment E=1.2e-24 TIGR02225: tyrosine recombinase XerD" amino acids 21 to 307 (287 residues), 384.6 bits, see alignment E=1.5e-119 PF13495: Phage_int_SAM_4" amino acids 30 to 96 (67 residues), 28.1 bits, see alignment E=3.1e-10 PF00589: Phage_integrase" amino acids 125 to 295 (171 residues), 200.6 bits, see alignment E=2.5e-63

Best Hits

Swiss-Prot: 66% identical to XERD_SALTY: Tyrosine recombinase XerD (xerD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 94% identity to amc:MADE_03409)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>MIT1002_00786 Tyrosine recombinase XerD (Alteromonas macleodii MIT1002)
MAKTQRELTYVPAASQAHIDGFIEMLWLEKGLSDHTQQSYRTDLTKLAIFSNNQGVKDIA
VLTTEQLQDYLAYRHDKGLSTRSTQRALSAIRAFFVFLISKQVRVDSPVSALSNPKTPKA
LPSSLSEQQVEDLLNAPLTDDPIECRDKSMLEVLYATGLRVSELIGLTMDQISLQQGVVR
VVGKGNKERLVPLGEDAIEWLLTYIKTARPILASKASDVVFLSKRGQKMTRQTFWHRIKY
YAVKAGIEQHLSPHTLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLQTL
IHSHHPRG