Protein Info for MIT1002_00781 in Alteromonas macleodii MIT1002

Annotation: Ribosomal RNA small subunit methyltransferase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF00398: RrnaAD" amino acids 8 to 265 (258 residues), 277.1 bits, see alignment E=5.9e-87 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 9 to 265 (257 residues), 298.7 bits, see alignment E=1.6e-93

Best Hits

Swiss-Prot: 68% identical to RSMA_PASMU: Ribosomal RNA small subunit methyltransferase A (rsmA) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 97% identity to amc:MADE_03414)

MetaCyc: 63% identical to 16S rRNA (A1518/A1519-N6-dimethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11633 [EC: 2.1.1.182]

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>MIT1002_00781 Ribosomal RNA small subunit methyltransferase A (Alteromonas macleodii MIT1002)
MSKTHLGHTARKRFGQNFLHDDYVIGKIVAAIAPKNEQNLVEIGPGLGALTDPVCEEVDA
LTVIELDRDLAKRLRHHPFNGNKLTVIEQDAMTMDFGALSKEMPVKDKKLRVFGNLPYNI
STPLMFHLFDHAHCIEDMHFMLQKEVVNRLAAGPGSKNYGRLSVMAQYYCHVIPVLNVPP
GAFKPPPKVDSAVVKLVPHQAPPVDVESVNTLERVCAQAFNQRRKTIRNSLKDSLSEEEI
RELGIDPTSRAEVLSLNDFATIANAVSAKEHQQEQ