Protein Info for MIT1002_00776 in Alteromonas macleodii MIT1002

Annotation: Lysine-sensitive aspartokinase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00656: aspartate kinase, monofunctional class
  • amino acids 5 to 449 (445 residues), 406.1 bits, E=1.7e-125
• TIGR00657: aspartate kinase
  • amino acids 6 to 449 (444 residues), 421.3 bits, E=5.4e-130
• PF00696: AA_kinase
  • amino acids 7 to 279 (273 residues), 168.8 bits, E=1.7e-53
• PF22468: ACT_9
  • amino acids 389 to 447 (59 residues), 53.7 bits, E=1.4e-18

Best Hits

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 97% identity to amc:MADE_03418)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• spermidine biosynthesis II (3/4 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• superpathway of polyamine biosynthesis III (3/8 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.4

Use Curated BLAST to search for 2.7.2.4

Protein Sequence (449 amino acids)

>MIT1002_00776 Lysine-sensitive aspartokinase 3 (Alteromonas macleodii MIT1002)
MTNALSIAKFGGTSVANYEVMQNCARIVAGNDKTRIVVVSAAAGVTNHLVSLAHTPMTQQ
QIEETCQAIINIELAILNKLKDKDAVEPKLNDLLDEMRSLAFHEEILHRDDLKDQLLSMG
ERMSSLMFSSVLAEQGVKTMNFDVRKVLRTDSEFGEGVPQIEEIEKLSKQLLAPEIKDAI
VVTQGFVGADEEGRTTTLGRGGSDFTAALLAEALDAESCEIWTDVTGVYTTDPRITPAAH
PLPELSFEEAAEMATFGAKVLHPATMEPALRKDIKVFVGSSKEPEKGGTWIVRDCEHEPP
YRAITRRKEQVMVTVKTPKMMYAQGFLQQVFAIIAKHKLSVDLVTTSEISVSFTLDNPAN
SVAQRLNKETIAELETICDVKVEKGYDLVTVVGNNMQTAVGVSSKILAAVSDFNLRMICF
GANPHNLSFLVNETDSDDVVRKLHTALFE