Protein Info for MIT1002_00776 in Alteromonas macleodii MIT1002
Annotation: Lysine-sensitive aspartokinase 3
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 97% identity to amc:MADE_03418)Predicted SEED Role
"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)
MetaCyc Pathways
- aspartate superpathway (23/25 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
- L-lysine biosynthesis I (9/9 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- superpathway of L-threonine biosynthesis (6/6 steps found)
- superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
- superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
- L-lysine biosynthesis III (6/7 steps found)
- L-lysine biosynthesis VI (6/7 steps found)
- L-homoserine biosynthesis (3/3 steps found)
- dipicolinate biosynthesis (3/4 steps found)
- spermidine biosynthesis II (3/4 steps found)
- L-lysine biosynthesis II (6/9 steps found)
- chorismate biosynthesis II (archaea) (8/12 steps found)
- L-methionine biosynthesis IV (2/4 steps found)
- ectoine biosynthesis (2/5 steps found)
- 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
- norspermidine biosynthesis (2/6 steps found)
- superpathway of polyamine biosynthesis III (3/8 steps found)
- cremeomycin biosynthesis (2/7 steps found)
- grixazone biosynthesis (2/8 steps found)
- platensimycin biosynthesis (6/26 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of plant hormones
- Glycine, serine and threonine metabolism
- Lysine biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.7.2.4
Use Curated BLAST to search for 2.7.2.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (449 amino acids)
>MIT1002_00776 Lysine-sensitive aspartokinase 3 (Alteromonas macleodii MIT1002) MTNALSIAKFGGTSVANYEVMQNCARIVAGNDKTRIVVVSAAAGVTNHLVSLAHTPMTQQ QIEETCQAIINIELAILNKLKDKDAVEPKLNDLLDEMRSLAFHEEILHRDDLKDQLLSMG ERMSSLMFSSVLAEQGVKTMNFDVRKVLRTDSEFGEGVPQIEEIEKLSKQLLAPEIKDAI VVTQGFVGADEEGRTTTLGRGGSDFTAALLAEALDAESCEIWTDVTGVYTTDPRITPAAH PLPELSFEEAAEMATFGAKVLHPATMEPALRKDIKVFVGSSKEPEKGGTWIVRDCEHEPP YRAITRRKEQVMVTVKTPKMMYAQGFLQQVFAIIAKHKLSVDLVTTSEISVSFTLDNPAN SVAQRLNKETIAELETICDVKVEKGYDLVTVVGNNMQTAVGVSSKILAAVSDFNLRMICF GANPHNLSFLVNETDSDDVVRKLHTALFE