Protein Info for MIT1002_00764 in Alteromonas macleodii MIT1002

Annotation: Signal transduction histidine-protein kinase BarA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 875 TIGR00229: PAS domain S-box protein" amino acids 44 to 173 (130 residues), 52.7 bits, see alignment E=2.2e-18 PF13188: PAS_8" amino acids 46 to 96 (51 residues), 23.4 bits, see alignment 1.5e-08 PF00989: PAS" amino acids 47 to 163 (117 residues), 45 bits, see alignment E=3.6e-15 PF08448: PAS_4" amino acids 53 to 167 (115 residues), 38.1 bits, see alignment E=5.7e-13 PF13426: PAS_9" amino acids 59 to 164 (106 residues), 32.5 bits, see alignment E=3.1e-11 PF00512: HisKA" amino acids 186 to 250 (65 residues), 68.1 bits, see alignment 2e-22 PF02518: HATPase_c" amino acids 298 to 407 (110 residues), 102.9 bits, see alignment E=5.1e-33 PF00072: Response_reg" amino acids 569 to 679 (111 residues), 87.3 bits, see alignment E=2.8e-28

Best Hits

KEGG orthology group: None (inferred from 72% identity to amc:MADE_03428)

Predicted SEED Role

"FOG: CheY-like receiver"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (875 amino acids)

>MIT1002_00764 Signal transduction histidine-protein kinase BarA (Alteromonas macleodii MIT1002)
MGEPWYVFTTLVPVIKSSPRVDHLIAIATDISEQKRLETRLSEGRAFYRSITDSIGEGVY
AVNGEGTTQFLNPAASRLLGWSLDELQGRRFHDTVHYQKGDGTLLPREQCPVNLTIRSGQ
SYTSYEDFFTDKRGRLFPISIVAVPLLDKEGKPDGHVGVFNDISGQKAIEQKLQKAYDEA
QSANKAKSDFLATMSHEIRTPMNAIIGLTHLALESTDNEQRQQYLEKVQRSSTALLDLMN
SILDFSKVEADKIEIIDEPFTLTKTIDKLAQVFQVKAQQKQLQLLFDIRCHTNLQCRGDS
EKIYQVLLNLLSNAIKFTASGHVILTVEKRENQLAFSVSDTGMGISEQVKSKLFKAFVQA
DASISREYGGTGLGLAICKRLVELMGGDLTLESEVDKGSCFSFALPVCSDEGPGTGPQLP
VSVPDNVLCIQTHESVSQGCEILAATLNRHNIHCQIIDQVEGLLPSKASQTIAFLPDDEQ
SWNSFIKHMQFGEYQSLNLTTLISPLNKQDVQKRMGSALVQNINIIELPFTDTELISTLS
PAQLSLSKRTIEGLESRKWRTRRLLNKHVLVVDDDAISVEISQQILSDLGINVAVASSGE
QALALCEMSKFDAILLDCYLPGVSGYEVAEQLTQKKDWYTPIIALSADESQEASESALTA
GMCQHLVKPATADEIVHTIDIHIHSGYIEITPPDEMSQFISSLLTFYKTYSQRGVMSDLL
DIFHTQANTSKLLTSLLEDAQLIGATTLEQSLLPLIEAQERNEAVNARHVTNLSFQLDAT
LRLIAHTIDKNDTDNIHQSGTNFDKSSMLSTLRNVEQALQSYDAKAVEYINVLAANYSDS
VYAHKINRLKQLATIYDFESAQTVITQLIGDITDE