Protein Info for MIT1002_00752 in Alteromonas macleodii MIT1002

Annotation: Phosphate regulon sensor protein PhoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 10 to 27 (18 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details PF11808: PhoR" amino acids 6 to 91 (86 residues), 91.5 bits, see alignment E=7.4e-30 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 95 to 423 (329 residues), 454.2 bits, see alignment E=1.2e-140 PF00512: HisKA" amino acids 205 to 270 (66 residues), 70.2 bits, see alignment E=2.5e-23 PF02518: HATPase_c" amino acids 317 to 426 (110 residues), 84.9 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 46% identical to PHOR_PSEAE: Phosphate regulon sensor protein PhoR (phoR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 98% identity to amc:MADE_03439)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>MIT1002_00752 Phosphate regulon sensor protein PhoR (Alteromonas macleodii MIT1002)
MYYPFSWLRSTLRLVLFLVVFALVGWYLDDMLFAVAIGATLLLLFNYWHLYKLNRWLWHS
RKMSPPTVRGVWEHIYEGIYYLQRRNRNKRKELGELVKRFREGSEALPDAAVVVDAKACI
IWCNRLARLDLGLKWPQDSGRRIDNLLRHPEFIQYFHAGNYKYPIEVPSPTNPNKTFEYR
IMPYGDEHLLLIARDITRVSQLEEMRKDFVANVSHELRTPLTVINGYLEILPIDEDSDPF
MQKAMKEMTSQTHRMQNLIEDLLVLSRIEASSERIYENVVNIPVVLAQVEREAQALNKEK
NHTINFHIDKELYVFGVETELRSACSNLVFNAVHYTPAGGEINVYWRRKPNGAQFSVVDN
GDGIEPNHLNRLTERFYRVDKARSRKTGGSGLGLSIVKHVLSHHNSRLDITSTLGEGSNF
SFVLDNELIAEQL