Protein Info for MIT1002_00751 in Alteromonas macleodii MIT1002

Annotation: Phosphate regulon transcriptional regulatory protein PhoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR02154: phosphate regulon transcriptional regulatory protein PhoB" amino acids 1 to 226 (226 residues), 367.7 bits, see alignment E=9e-115 PF00072: Response_reg" amino acids 5 to 117 (113 residues), 105 bits, see alignment E=2.5e-34 PF00486: Trans_reg_C" amino acids 151 to 225 (75 residues), 95.9 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 76% identical to PHOB_ECOLI: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Escherichia coli (strain K12)

KEGG orthology group: K07657, two-component system, OmpR family, phosphate regulon response regulator PhoB (inferred from 98% identity to alt:ambt_14930)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>MIT1002_00751 Phosphate regulon transcriptional regulatory protein PhoB (Alteromonas macleodii MIT1002)
MSRTVLVVEDEAPIREMLKFVLEQSGFNIIEAEDFDIAQEKICEPYPDLILLDWMLPGGS
GVQLAKSLKQHEFTRDIPVIMLTARGEEEDKIRGLDAGADDYVTKPFSPKELVARIKAVM
RRVTPTSSEEPIEFNGLKLEPVSHRVMANEEPLDMGPTEFKLLHFFMTHPERVYSRELLL
DNVWGTNVYVEDRTVDVHIRRLRKAISRHGHDAMIQTVRGAGYRFSTKL