Protein Info for MIT1002_00747 in Alteromonas macleodii MIT1002

Annotation: Inner membrane protein YdcO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details PF03594: BenE" amino acids 4 to 386 (383 residues), 378.8 bits, see alignment E=1.5e-117 TIGR00843: benzoate transporter" amino acids 9 to 387 (379 residues), 296.7 bits, see alignment E=1.3e-92

Best Hits

KEGG orthology group: K05782, benzoate membrane transport protein (inferred from 93% identity to amc:MADE_03444)

Predicted SEED Role

"Benzoate transport protein" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>MIT1002_00747 Inner membrane protein YdcO (Alteromonas macleodii MIT1002)
MSKWKLSHISAGLTAVTVGYSSSVVIIIDVARKAGASDDMVVSWLLALGLGMGITCILFS
WLSKLPVVTAWSTPGAAFLLTSIGEYRLSEAIGAFILCALLSLVTAQSRSLLKQISRIPP
AISSALLAGILLPICLAIFSDVNDAPYLVALFIAAYLVGSRLFPRYLMLLLLVMSVTISL
FMSSADGVVALPSDSPGLSSMFTLPEPIWVTPTFSLSAAIGLAFPLFLITTLSQNLPGIA
IHHAHGYTPDHKPILSGIAIVQALLAPFGGFSFNLAAITAALCMGEQADNEKSQRYKAAI
AAGVAYLFMGLLASVVVALFVSMPSIIIHLLAGLALLATLQGAVVRAMEVEHHRAPALLT
MLCTASGFSLYSMTSAVWGLGLGLLLLYVQKKPVSA