Protein Info for MIT1002_00744 in Alteromonas macleodii MIT1002

Annotation: HIT-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 4 to 105 (102 residues), 91.4 bits, E=5.4e-30
• PF01230: HIT
  • amino acids 12 to 107 (96 residues), 93 bits, E=1.5e-30

Best Hits

Swiss-Prot: 59% identical to HINT_HAEIN: Purine nucleoside phosphoramidase (HI_0961) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 94% identity to amc:MADE_03447)

MetaCyc: 57% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Protein Sequence (123 amino acids)

>MIT1002_00744 HIT-like protein (Alteromonas macleodii MIT1002)
MAETIFDKIISKEIPADILYEDELALAFKDINPQAPTHFLVIPKKQIATVNDIAEEDREV
VGHLSFVAAKIAKEQGFADQGFRTVMNCNEYGGQTVYHIHLHVLAGKPLGWPPYTENMKQ
HVE