Protein Info for MIT1002_00740 in Alteromonas macleodii MIT1002

Annotation: G3P acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 80 to 101 (22 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 144 to 175 (32 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 3 to 195 (193 residues), 214 bits, see alignment E=8.7e-68 PF02660: G3P_acyltransf" amino acids 11 to 184 (174 residues), 165.5 bits, see alignment E=5.9e-53

Best Hits

Swiss-Prot: 68% identical to PLSY_PSEHT: Glycerol-3-phosphate acyltransferase (plsY) from Pseudoalteromonas haloplanktis (strain TAC 125)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 94% identity to amc:MADE_03451)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>MIT1002_00740 G3P acyltransferase (Alteromonas macleodii MIT1002)
MISLTLLMIAVAYLFGSLSSAVVISQLFGLPDPRTAGSKNPGATNVYRLGGRVPALLVLV
MDILKGTIPVYGSYFLGIEPIMLGVIAIFACLGHIFPLYFGFKGGKAVATAFGAMLPIGL
DLAGLLILSWVVVVFLTGYSSLGALIAVSLAPLFTFLIKPLYTVPVAMLSLLIILRHKDN
IARLLAGNESKVWDKGKVKE