Protein Info for MIT1002_00728 in Alteromonas macleodii MIT1002

Annotation: Multidrug transporter MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01730: efflux transporter, RND family, MFP subunit
  • amino acids 42 to 346 (305 residues), 264.1 bits, E=7.7e-83
• PF16576: HlyD_D23
  • amino acids 58 to 266 (209 residues), 105.3 bits, E=4.4e-34
• PF13437: HlyD_3
  • amino acids 163 to 264 (102 residues), 53.4 bits, E=5.8e-18

Best Hits

KEGG orthology group: None (inferred from 86% identity to amc:MADE_01736)

MetaCyc: 34% identical to vibriobactin efflux pump periplasmic adaptor protein (Vibrio cholerae O1 biovar El Tor str. N16961)
TRANS-RXN-502

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Protein Sequence (349 amino acids)

>MIT1002_00728 Multidrug transporter MdtA (Alteromonas macleodii MIT1002)
MSSRLSLSPLLLGVVLLAGVVVYLNMPEEESASNSIVRATPVKTALVSSQAFPITIESLG
TATANESVNITAQVTDTVKTINFEDGDKATEGELLVQLNNTEERARVEELKANIDEAKRQ
FTRISDLRQSNATSEQLLDEQQARVKALQAQLDVALAQLNDLQIRAPFSGLLGNREISIG
SLVQPGDTITTLDDISLIKVDFSIAESHLASVAKGQALSASSVAYPGEEFTGKISNIDTR
LDPISRSIRVRATIDNQDNRLRPGMLLTVIVEKRVLNTLVLPEKALVPVQDKQYVYVVKD
NVAHQTEVVIGERRPGLVQIVSGLNEGDEVITEGTLRVRDQSPVNVLNR