Protein Info for MIT1002_00710 in Alteromonas macleodii MIT1002

Annotation: Bicarbonate transport system permease protein CmpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 139 to 322 (184 residues), 78.5 bits, see alignment E=2.9e-26

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 96% identity to amc:MADE_03653)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>MIT1002_00710 Bicarbonate transport system permease protein CmpB (Alteromonas macleodii MIT1002)
MSKMTTILRLPSSPSNANSLLSRLYQSTPALLLPVIGLLMFLAIWNGVAKSIDTSLGQFP
GPAQVFEQAGALIDEHIAQREKADAFYQRQEARNAARVAQDPTYQPKIREFTGAPTFFDQ
IWTSLYTVMVGFLIASVIAVPVGILCGLSKSAYTAINPLIQLFKPVSPLAWLPLVTMVVS
ALYVSDDPAFSKSFVTSAFTVSLCCLWPTLINTAVGVSNIDKDLINVSKVLRLTPFANLT
KIVLPSSIPMIFTGLRLSLGIGWMVLIAAEMLAQNPGLGKFVWDEFQNGSSESLARIMVA
VLTIGAIGFVLDRLMLSIQRAVSWDKSSVLR