Protein Info for MIT1002_00689 in Alteromonas macleodii MIT1002

Annotation: Ribosomal RNA large subunit methyltransferase G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05175: MTS
  • amino acids 231 to 405 (175 residues), 156.8 bits, E=8.4e-50
• PF06325: PrmA
  • amino acids 256 to 317 (62 residues), 29.2 bits, E=1.4e-10
• PF13847: Methyltransf_31
  • amino acids 260 to 324 (65 residues), 29.6 bits, E=1.1e-10
• PF03602: Cons_hypoth95
  • amino acids 260 to 354 (95 residues), 27.1 bits, E=6e-10

Best Hits

Swiss-Prot: 86% identical to RLMG_ALTMD: Ribosomal RNA large subunit methyltransferase G (rlmG) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: None (inferred from 86% identity to amc:MADE_03670)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (410 amino acids)

>MIT1002_00689 Ribosomal RNA large subunit methyltransferase G (Alteromonas macleodii MIT1002)
MNTEFIFADRQFSLIRYPEKHQHISLQAWDSADELVIEHIESLLSEASLSIGSGDNEGTM
MIFNDDFGALGCWFSHLAPYWVSDSYISLRSLSENLKANHLLSNAETGNKNGLLTAPLKT
LTSVQSLTFKPEKAPSLVVLKVPRALALLEQQLIDLQKYITPDTRVIATGKVKTITKSVL
NLFERYIGPTTTSLAKKKSRLVFASPRESIKLSDSPYPTRWQCKSTMGTALTIDNLANTF
SRQSLDIGARIMLEHMTVSANDVVVDLGCGNGVLGVNALSLAPDAKVIFVDESYMALESA
RLNVLNNFPDKIDQCEFVASNCLETLINRENKPAVTKILCNPPFHQQNAITDHIAWQMFT
DSRDVLIKSGHLVVVGNRHLDYHIKLKKLFGGAKVLASDKKFVILGTSKR