Protein Info for MIT1002_00685 in Alteromonas macleodii MIT1002

Annotation: putative TonB-dependent receptor precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 23 to 97 (75 residues), 42.3 bits, see alignment E=1.7e-14 PF13715: CarbopepD_reg_2" amino acids 24 to 103 (80 residues), 35.4 bits, see alignment E=1.7e-12 PF07715: Plug" amino acids 118 to 221 (104 residues), 69.2 bits, see alignment E=8.3e-23 PF00593: TonB_dep_Rec" amino acids 377 to 769 (393 residues), 126.3 bits, see alignment E=6.5e-40

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 88% identity to amc:MADE_03676)

Predicted SEED Role

"Zinc-regulated outer membrane receptor" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (800 amino acids)

>MIT1002_00685 putative TonB-dependent receptor precursor (Alteromonas macleodii MIT1002)
MKMRSLLSLSIAGLLSAPVYATTVTGKVTDTAGQPVAGAEVKIEGSRRVAYTDANGIYRF
DDVKQPHIHLHVYSSNYIHGDNDLGDVNTDQNVDFVLKPASVENIVVTANALQSSVLESV
TPVTVIGAEKLRKIEAPTLGETLKNAPGVHSTYFGPVSSSPVIRGNDGPRVKIVQNGLDV
SDVSRVGPDHNVATTLSSATQVEVLRGPATLQYGSGAIGGVVNVVDKRIPQYQIDGVEGE
AETSYSTVNNGSYTRADVTGGSGNIAWHVDGFYRDTDNADIPGFASIDPDEDEPNGVLES
SAMETRNVVAGLSYVAEEGYFGFAVEQLDNKYGVPGHSHAHGEEEHEGEDHDLEEHDHEE
HAEEGVLLDVDMTRYQAAGEWHSPFEGITNLKFAAAYTDYEHAEIEDGEPGTVFTNESSD
IRLSAYHEEVNGWHGVFGLQFNHSDYNAVGEEAFTPANTTSSYALYLIEQKKVGNVTFEL
GGRLERTTLDADASEVELDVLHDEHEGEEHAVAFNFPDYDFTSLSLSAGANWEYQEGHSV
AVTLSRSERAPSQQELFSAGQHLATQSYEVGLVFDMDEEGHIEETLKGVKEEVSTNLDIT
FRKFTGSWGYSASFFYNQADDYIFQTSTGLIALSEHEEHEEHGHDEHGDEEGLPIYYFQQ
ADADIWGFEAETYVDLSDTLRLTVFGDFIRAEIEDDNLPRTPPMRFGSELSYVNDGLSAD
VGFTWYDDQNDVASFETATDGYTLVNASVQYEFGTQGIDWVVFARGENLTDEEARVHTSF
LKDQAPLPGRNFTMGVRALF