Protein Info for MIT1002_00668 in Alteromonas macleodii MIT1002

Annotation: Ion transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 81 to 97 (17 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 202 to 227 (26 residues), see Phobius details PF00520: Ion_trans" amino acids 16 to 235 (220 residues), 149.7 bits, see alignment E=8.6e-48 PF08016: PKD_channel" amino acids 110 to 228 (119 residues), 32.3 bits, see alignment E=6.8e-12

Best Hits

KEGG orthology group: K08714, voltage-gated sodium channel (inferred from 95% identity to amc:MADE_03691)

Predicted SEED Role

"FIG00950713: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>MIT1002_00668 Ion transport protein (Alteromonas macleodii MIT1002)
MQASELQNKFERIRANKWFEAFVISVIVISALLVGAKTYELPAGMSSVTLFLDWFISAFF
LTEITIRFLAEKRKRYFFKSFWNWFDTLIVVISLIPADDTELALIARLVRVFRVLRMISI
IPELRILLVSLVKALPQLAYVMLLMFIIFYIYAAIGSTLFETINPVLWGDITISMLTLFR
IMTFEDWTDVMYETQEVYSLSWIFYLTFIFFTAFAFLNMVIGIVVNVMERENEKARAEKE
AALLEEQIAQGNVEPTLQDVMKELRELKAQVTANNEHSTVSKTS