Protein Info for MIT1002_00651 in Alteromonas macleodii MIT1002
Annotation: Thymidylate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 75% identical to TYSY_TERTT: Thymidylate synthase (thyA) from Teredinibacter turnerae (strain ATCC 39867 / T7901)
KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 98% identity to amc:MADE_03706)Predicted SEED Role
"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)
MetaCyc Pathways
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
- folate transformations III (E. coli) (9/9 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
- folate transformations II (plants) (10/11 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
- superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
- dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
- pyrimidine deoxyribonucleosides salvage (4/5 steps found)
- pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.1.1.45
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (277 amino acids)
>MIT1002_00651 Thymidylate synthase (Alteromonas macleodii MIT1002) MKEYLALMRHVRDTGVKKEDRTGTGTLSVFGYQMRFNLQEGFPLVTTKKCHLKSIIHELL WFLKGETNIAYLKEHGVSIWDEWATEEGELGPVYGHQWRSWDRGDGTSVDQIAEVVEQIK NNPDSRRLIVSGWNPAVLPDTNYSPKENAAMGKQALPPCHTLFQFYVLDGKLSCQLYQRS GDIFLGVPFNIASYALLTMMMAQVCDLEPGDFIHTLGDAHLYSNHLEQVELQLSREPFER PTMEINPEVKDIFGFSFDDFTLKNYQSHPHIKAPVAI