Protein Info for MIT1002_00651 in Alteromonas macleodii MIT1002

Annotation: Thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00303: Thymidylat_synt
  • amino acids 2 to 277 (276 residues), 415.8 bits, E=3.1e-129
• TIGR03284: thymidylate synthase
  • amino acids 2 to 86 (85 residues), 139.6 bits, E=6.1e-45
  • amino acids 85 to 277 (193 residues), 304.3 bits, E=4.3e-95

Best Hits

Swiss-Prot: 75% identical to TYSY_TERTT: Thymidylate synthase (thyA) from Teredinibacter turnerae (strain ATCC 39867 / T7901)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 98% identity to amc:MADE_03706)

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• pyrimidine deoxyribonucleosides salvage (4/5 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Protein Sequence (277 amino acids)

>MIT1002_00651 Thymidylate synthase (Alteromonas macleodii MIT1002)
MKEYLALMRHVRDTGVKKEDRTGTGTLSVFGYQMRFNLQEGFPLVTTKKCHLKSIIHELL
WFLKGETNIAYLKEHGVSIWDEWATEEGELGPVYGHQWRSWDRGDGTSVDQIAEVVEQIK
NNPDSRRLIVSGWNPAVLPDTNYSPKENAAMGKQALPPCHTLFQFYVLDGKLSCQLYQRS
GDIFLGVPFNIASYALLTMMMAQVCDLEPGDFIHTLGDAHLYSNHLEQVELQLSREPFER
PTMEINPEVKDIFGFSFDDFTLKNYQSHPHIKAPVAI