Protein Info for MIT1002_00648 in Alteromonas macleodii MIT1002

Annotation: Phosphoenolpyruvate-protein phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 772 PF01590: GAF" amino acids 27 to 163 (137 residues), 79.9 bits, see alignment E=8.2e-26 PF13185: GAF_2" amino acids 31 to 161 (131 residues), 50.7 bits, see alignment E=6.7e-17 PF13492: GAF_3" amino acids 34 to 165 (132 residues), 45.2 bits, see alignment E=3.9e-15 TIGR01417: phosphoenolpyruvate-protein phosphotransferase" amino acids 188 to 755 (568 residues), 443.1 bits, see alignment E=6.8e-137 PF05524: PEP-utilisers_N" amino acids 188 to 310 (123 residues), 77.1 bits, see alignment E=4e-25 PF00391: PEP-utilizers" amino acids 340 to 412 (73 residues), 73.1 bits, see alignment E=3.3e-24 PF02896: PEP-utilizers_C" amino acids 442 to 730 (289 residues), 322.9 bits, see alignment E=5.4e-100

Best Hits

KEGG orthology group: K08484, phosphotransferase system, enzyme I, PtsP [EC: 2.7.3.9] (inferred from 96% identity to amc:MADE_03709)

Predicted SEED Role

"FIG001592: Phosphocarrier protein kinase/phosphorylase, nitrogen regulation associated"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (772 amino acids)

>MIT1002_00648 Phosphoenolpyruvate-protein phosphotransferase (Alteromonas macleodii MIT1002)
MSPQSQQGTMLTTLKRIVQEMNQIPALDTALFRLASRVKQTLDVDSCSIYLADYDTQEFI
LKATDGLHPDAVEQVRIGFSEGLIGLVGQREEPLNIVNAHSHPRFKHYPEVQEENYNAFL
GTPIINQRRVLGVITLQQSQMRRFSEDEEAFLVTLAAQLALEITNADIRGALTLSNSNDN
TARQKNVRGIAGSPGLAIGKGVSPDKSINLKNWVVKRTQSPQDQIQLYRKGVEVTRGHVD
ALSKRLDDGIPDDVKSIFQLYHHLLDANSLGREVEEKIRQGWDAASSLKMVVESYAARFQ
AMDDPYMQERAIDIVDLSDRILANILYEANGKKVTEKTITEASILVADEVSAPMLAEFPR
GKLKGIISIRGSNNSHAAILARAMGVPAVMGCQNVTPALLEDKEILLDGYSGEVIVSPER
NIKSEFIQLIEEESAIAEKIDAEADKPCESVDGCRMSLYINAGLSAEVELNAEQIGAGVG
LYRTEIPFMLRERFPSEQEQVKLYRQVLEAAPSLPITMRTLDVGGDKPLPYFPINEENPF
LGWRGIRLTLDHPEIFLVQVRAMLRASVGLSNLQIMLPMISTVSEVQESKRLINQAYYEI
CDEIAESGQTLTKPKLGIMLEVPSVLYQLPQLAKHVDFFSVGSNDLTQYLLAVDRNNTRV
AGLYNSYHPAVLGALYDVVQKANQNQVPVTICGEIAGEPAGALLLMGMGYRRLSMNGFNL
RKINWLIRKVTLDECKQLLSLALTSVSQEEVFVHLNQYLETKGLGGLIRAGA