Protein Info for MIT1002_00646 in Alteromonas macleodii MIT1002
Annotation: Methyl-directed mismatch repair protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to MUTH_ECO55: DNA mismatch repair protein MutH (mutH) from Escherichia coli (strain 55989 / EAEC)
KEGG orthology group: K03573, DNA mismatch repair protein MutH (inferred from 96% identity to amc:MADE_03711)MetaCyc: 59% identical to DNA mismatch repair protein MutH (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"DNA mismatch repair endonuclease MutH" in subsystem DNA repair, bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (225 amino acids)
>MIT1002_00646 Methyl-directed mismatch repair protein (Alteromonas macleodii MIT1002) MQPPASPPSSPDSLLARCHAIAGLTLGELADMANVAIPANLQRHKGWPGMLIEKWLGASA GSKPQQDFPELGIELKTIPIDAHFSPLETTYVCFAPLLMTPGITWETSNVRNKLQQVLWL PIEGDRAIPLAHRRVATGFYWRPNEHEDAVLRHDWEELVEQIATGQVESITSRQGEALHI RPKAANGKVLTDALGPEGQRIKTRPRGFYLRKTFTHQILINAFGG