Protein Info for MIT1002_00634 in Alteromonas macleodii MIT1002

Annotation: Methyl-accepting chemotaxis protein 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details PF17200: sCache_2" amino acids 39 to 184 (146 residues), 133.3 bits, see alignment E=1.8e-42 PF08269: dCache_2" amino acids 47 to 182 (136 residues), 128.4 bits, see alignment E=7.9e-41 PF17201: Cache_3-Cache_2" amino acids 89 to 181 (93 residues), 39.4 bits, see alignment E=1.2e-13 PF00672: HAMP" amino acids 207 to 258 (52 residues), 41.5 bits, see alignment 3.3e-14 PF00015: MCPsignal" amino acids 366 to 503 (138 residues), 129.8 bits, see alignment E=2.5e-41

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 92% identity to amc:MADE_03718)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>MIT1002_00634 Methyl-accepting chemotaxis protein 4 (Alteromonas macleodii MIT1002)
MWLRKFSLIQRLGIIVALITLLFVLLTAVVLNRHYEALKQKSYDENQHLVEVVHTMLSSF
AARTDVDEATAKQQALEAVKALRYDGSNYFWIQDQTPSMVMHPIKPALDGQDLRTFKDGN
GKAFFIEMAQKVKSKGEGFVDYVWPLPGEESPTDKISYVKEFKPWGWTVGSGIYLTNLEK
EFAHLRNVIAVFCLVSIVLVVVLVYVIGGSIVKPVQEVSERMKDISQGEGDLTRSLPETG
QDEVTRLARYFNEYTEKMRHSLLGIRENINSLTQQAELVETSSKNSNAQAQTQNENMLQV
AAAMEEMTTQINEVSNNADSAEKSTSSARGNVQNGASVVDSTVNDIRSLTSDIESVSSAV
TELAAQTESIGAVLDVIRGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLASRTG
QSTDEIQAMIEKLQSNAKSAVDAVKVSQSASTKTVDNAIQANQNLQEADRLMTEIADMSS
EIARATEQQAEAATEANMRINALSGAADSSLRTADELAAASQALRASCIAIMDIANRFKL