Protein Info for MIT1002_00608 in Alteromonas macleodii MIT1002

Annotation: heat shock protein HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details PF05569: Peptidase_M56" amino acids 105 to 210 (106 residues), 31.5 bits, see alignment E=1.1e-11 PF01435: Peptidase_M48" amino acids 150 to 244 (95 residues), 35.9 bits, see alignment E=6.9e-13

Best Hits

KEGG orthology group: None (inferred from 74% identity to spc:Sputcn32_3998)

Predicted SEED Role

"Regulatory sensor-transducer, BlaR1/MecR1 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>MIT1002_00608 heat shock protein HtpX (Alteromonas macleodii MIT1002)
MLVGNLAITLNLLSIAVLAFAISVVFIAVISPFTLHRIAQFTFGIRKVILWSLVTAPWWI
AISCVGFFWPRQQDIFPAAWLNEFAHWHHVDIFSFTSWHAVTLLSASAYLLWSVTRTVYI
RRKQSSAMADLIGLSDIKLQHINGKQGYYSLPLPIPAAFTTGLLSPKIYVTAALKERVNE
QELDIIIRHEMAHVEARDPMYKVVFATFAAFFPATATRELIKQFTLLTEQMADSAVTKEY
HNLDVAQTLINVARMQRSVDSMHNNMGCEGLQTSYFGNDQTSVRVQSLISPVMSSSRLAM
GFAIILFASAPLLTASTVDSLHHIIETFFTH