Protein Info for MIT1002_00590 in Alteromonas macleodii MIT1002

Annotation: Type I restriction enzyme EcoKI M protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 transmembrane" amino acids 385 to 403 (19 residues), see Phobius details TIGR00497: type I restriction-modification system, M subunit" amino acids 6 to 509 (504 residues), 645.5 bits, see alignment E=3.2e-198 PF12161: HsdM_N" amino acids 10 to 158 (149 residues), 61.6 bits, see alignment E=2e-20 PF02384: N6_Mtase" amino acids 172 to 487 (316 residues), 384.1 bits, see alignment E=8e-119 PF07669: Eco57I" amino acids 275 to 387 (113 residues), 26.2 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 82% identical to T1M1_ECOLX: Type I restriction enzyme EcoR124II M protein (hsdM) from Escherichia coli

KEGG orthology group: K03427, type I restriction enzyme M protein [EC: 2.1.1.72] (inferred from 93% identity to sfr:Sfri_1953)

Predicted SEED Role

"Type I restriction-modification system, DNA-methyltransferase subunit M (EC 2.1.1.72)" in subsystem Restriction-Modification System (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (526 amino acids)

>MIT1002_00590 Type I restriction enzyme EcoKI M protein (Alteromonas macleodii MIT1002)
MTSIQQRAELQRQIWAIANDVRGSVDGWDFKQYVLGTLFYRFISENFVNYITGGDESVNY
AAMSDDDENIKFAKEDAIKTKGYFLYPSQLFSNVAANAHKNENLNTDLAAIFAAIENSAN
GYDSEKDIKGLFADFDTTSNRLGNTVEAKNKRLAAVLKGVAGLTFGNFEDNQIDLFGDAY
EFLISNYAANAGKSGGEFFTPQHVSRLIAQLAMHGQTSVNKIYDPAAGSGSLLLQAKKHF
DAHIIEDGFFGQELNHTTYNLARMNMFLHNINYDKFNIQLGDTLTEPHFLDDKPFDAIVS
NPPYSVKWIGSDDPTLINDDRFAPAGVLAPKSKADFAFVLHALSYLSSKGRAAIVCFPGI
FYRGGAEQKIRQYLVDNNYVETVISLAPNLFFGTTIAVNILVLSKHKTDTTTQFIDASGL
FKKETNNNVLTDNDDEKNPGHIQQIMKVFASKENVDHFAKSVDLDVIAGNSYNLSVSSYV
EAKDNRELVDITDLNAELKTTVAKIDALRSDIDAIVAEIEGEELEA