Protein Info for MIT1002_00533 in Alteromonas macleodii MIT1002

Annotation: Adenylosuccinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF00709: Adenylsucc_synt" amino acids 6 to 424 (419 residues), 612 bits, see alignment E=2.4e-188 TIGR00184: adenylosuccinate synthase" amino acids 6 to 430 (425 residues), 639.9 bits, see alignment E=9.4e-197

Best Hits

Swiss-Prot: 99% identical to PURA_ALTMD: Adenylosuccinate synthetase (purA) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 99% identity to amc:MADE_00585)

MetaCyc: 74% identical to adenylosuccinate synthetase (Escherichia coli K-12 substr. MG1655)
Adenylosuccinate synthase. [EC: 6.3.4.4]

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>MIT1002_00533 Adenylosuccinate synthetase (Alteromonas macleodii MIT1002)
MAKNVVVLGTQWGDEGKGKVVDLLTDRAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGI
LRDNVTCIIGNGVVLSPDALMKEMTMLEERGVPVRERLKISEACPLILPYHIALDVAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNAEDFAAKLKEVLDVHNFTLTQYYGEE
AVDFDETLKGAMEVADILKAMVVDVTDELDKAHNAGLPIMFEGAQGTLLDIDHGTYPYVT
SSNTTVGGVATGAGFGPLKLDYVLGIVKAYTTRVGSGPFPTELECEVGQHLGVKGHEFGA
TTGRKRRTGWFDAVAMKRAVQINSITGFCLTKLDVLDGLESLQICVGYKDADGNVKDVPP
MAADGYEKVTPVYEEMPGWTDNTFGVTEFEALPQAAKNYIKRLEELTGVPVDIVSTGPDR
NETIVLRSPYDA