Protein Info for MIT1002_00508 in Alteromonas macleodii MIT1002

Annotation: Sec-independent protein translocase protein TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 155 to 181 (27 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 7 to 224 (218 residues), 244.1 bits, see alignment E=7.4e-77 PF00902: TatC" amino acids 9 to 219 (211 residues), 237.1 bits, see alignment E=9.2e-75

Best Hits

Swiss-Prot: 64% identical to TATC_ECOL6: Sec-independent protein translocase protein TatC (tatC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 95% identity to amc:MADE_00562)

MetaCyc: 63% identical to twin arginine protein translocation system - TatC protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>MIT1002_00508 Sec-independent protein translocase protein TatC (Alteromonas macleodii MIT1002)
MSDANNLISHLIELRSRILKALLSVLIVFICLAAFAQDLYKLLAMPLLEALPENASMIAT
DVASPFFAPFKLTLVLSFFIAIPYVLYQVWGFVAPGLYRNEKRLVAPLLLSSTLLFYAGM
AFAYFVVFPIAFAFFTSVAPEGVTVSTDISSYLNFVLKLFFAFGVSFEIPIAIILMCWTG
VTDAKSLRAKRPYVVVGAFVVGMLLTPPDVISQTLLAIPMWLLFEVGVIVGGFYAGKTPK
DDTSTETTDNT