Protein Info for MIT1002_00494 in Alteromonas macleodii MIT1002

Annotation: Phosphatidylserine decarboxylase proenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF27523: PSD" amino acids 5 to 46 (42 residues), 64.7 bits, see alignment 4.9e-22 TIGR00163: phosphatidylserine decarboxylase" amino acids 49 to 284 (236 residues), 262.5 bits, see alignment E=1.4e-82 PF02666: PS_Dcarbxylase" amino acids 63 to 280 (218 residues), 203.4 bits, see alignment E=3.1e-64

Best Hits

Swiss-Prot: 86% identical to PSD_ALTMD: Phosphatidylserine decarboxylase proenzyme (psd) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 86% identity to amc:MADE_00549)

MetaCyc: 54% identical to phosphatidylserine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>MIT1002_00494 Phosphatidylserine decarboxylase proenzyme (Alteromonas macleodii MIT1002)
MLDWLKVNLQYVTPKHLLSRLVGKLAEAEMGSVTTFFIKAFIKQYNVDMSEALHEEPEHY
RSFNKFFTRPLKPEARTIDENDDVLIHAVDGTVSQFGDIHSDSIFQAKGHDFSLTTLLGG
KPDVAAPFKNGKFATIYLAPRDYHRIHMPVEGTLTDMLYVPGELFSVNPLTAQNIPGLFA
RNERVVALFDTPVGKMAMVLVGATIVASIETVWAGTVTPPAGKNVQHWSYEKDSEAAVFL
EKGAELGRFKLGSTIVVCFEKDMIDFEDLAPGMVTRLGEPMALKSTAQATAKDTHVSDES
ASDEKSEASSEGADS