Protein Info for MIT1002_00467 in Alteromonas macleodii MIT1002

Annotation: Argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 TIGR00838: argininosuccinate lyase" amino acids 3 to 452 (450 residues), 628.1 bits, see alignment E=4.9e-193 PF00206: Lyase_1" amino acids 6 to 301 (296 residues), 277.6 bits, see alignment E=1.6e-86 PF14698: ASL_C2" amino acids 364 to 431 (68 residues), 86.8 bits, see alignment E=1.1e-28

Best Hits

Swiss-Prot: 98% identical to ARLY_ALTMD: Argininosuccinate lyase (argH) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 98% identity to amc:MADE_00528)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>MIT1002_00467 Argininosuccinate lyase (Alteromonas macleodii MIT1002)
MALWGGRFESGASSMFKQVNDSLPFDQVMASQDIQGSISWSRALQKAGVLTVDEQAQLES
ALSELKAKADAGELDFNASSEEDIHSFVEAALIEKLGDIGRKLHTGRSRNDQVATDFRLW
VREHIASLRADVLGVIKSLLNAASRHQEAIIPGYTHLQRAQPIHFAHWCLAYVEMLKRDL
SRLDDLKVRMNQCPLGSGALAGTTFPVDRHAIAEELGFDSPCLNSLDAVSDRDFVLELLF
VASTSMMHLSRLAEDMIFYNSGEAGFLQLGDSVTSGSSLMPQKKNPDALELMRGKCGRVF
GSLQALLVTMKGLPLAYNKDMQEDKEGAIDTVNQWHICLCIASEVLDSLQLNEERCRVAA
TQGFSNATELADYLVGKGVPFRTGHDIAGRVVLQAIDKGCAIEDLPLSDMQAICDKIEDD
VYPVLQLEYGVNQRNILGGTSKETVTKALYQELEDLDKQG