Protein Info for MIT1002_00449 in Alteromonas macleodii MIT1002

Annotation: Type IV pilus biogenesis and competence protein PilQ precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF11741: AMIN" amino acids 63 to 145 (83 residues), 36.4 bits, see alignment E=9.6e-13 TIGR02515: type IV pilus secretin PilQ" amino acids 178 to 586 (409 residues), 508.3 bits, see alignment E=9.4e-157 PF07660: STN" amino acids 205 to 251 (47 residues), 29.7 bits, see alignment 9.1e-11 PF03958: Secretin_N" amino acids 278 to 341 (64 residues), 57.2 bits, see alignment E=3.2e-19 PF00263: Secretin" amino acids 428 to 586 (159 residues), 167.9 bits, see alignment E=3.1e-53

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 93% identity to amc:MADE_00511)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (590 amino acids)

>MIT1002_00449 Type IV pilus biogenesis and competence protein PilQ precursor (Alteromonas macleodii MIT1002)
MAERYIFNKSLNRRVPRWYWLAFAVAAIFSLTVFVSPVKAQEPLLVDPDTKRNASTVTTT
VTNIDFTQAANNTAVTLVSFEGQAPKLQLIESQGKVSLTLPNTKLGEDQLVELNVTDFGT
LVSTIETFEDKDGARIEVNYSGPVTVKNTVKDGVIRMAITPMDSAQQDALEAEKKYTGDP
ISLDFQDVPVRQVLQIIAQVNGFNLVTTDTVTGNVTISLSGVPWDQALDMILRVKGLDKR
LEGNILLIAPAEELSARETQALQSKKQVSDLASLHTVNIPVNYAKAAALATILKSTEGGI
LSERGGVTVDERTNTLLIRDTLASIDEARKTINALDIPVKQVLIESRMVTVLDDVDEQLG
VRWGFSDRQDDNGVSGSLEAADTIAGGIVPSIDNRLNVNLPVTSAAGSIGFQIASLVDGT
ILDLELSALESENKGEIIASPRITVANQHEAYIEQGTEIPYVQATSSGATSVEFKKAVLS
LKVTPHITPDNRIILDLVVTQDTRGETVSTSTGDAVAIDTQEIKTQVLVENGETIVLGGI
FQQTSSDGVSKVPLFGDLPVVGALFRNSSQLQQKRELLIFVTPKIVTERP