Protein Info for MIT1002_00447 in Alteromonas macleodii MIT1002

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01357: 3-dehydroquinate synthase
  • amino acids 13 to 348 (336 residues), 389.9 bits, E=5.6e-121
• PF13685: Fe-ADH_2
  • amino acids 17 to 229 (213 residues), 44.1 bits, E=3.5e-15
• PF00465: Fe-ADH
  • amino acids 37 to 183 (147 residues), 28 bits, E=1.6e-10
• PF01761: DHQ_synthase
  • amino acids 65 to 323 (259 residues), 358.7 bits, E=2.4e-111

Best Hits

Swiss-Prot: 64% identical to AROB_PSEA6: 3-dehydroquinate synthase (aroB) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 94% identity to amc:MADE_00509)

MetaCyc: 60% identical to 3-dehydroquinate synthase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate synthase. [EC: 4.2.3.4]

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)
• superpathway of chorismate metabolism (42/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Protein Sequence (355 amino acids)

>MIT1002_00447 3-dehydroquinate synthase (Alteromonas macleodii MIT1002)
MSTLTVELGERSYPIQIEAGLLSQPGLFSAYIKGPLAVIVTNETVAPLYLETTKAACGDV
QVETIILPDGEQHKNLAQFEVVMTRLLELNAARDTTLIALGGGVIGDLTGFVAATYQRGV
PFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPVYVAIDTDTLATLPAREFAAGM
AEVIKYGIIYDAPFFEWLESNVDALTSLDTEILTQAISRCCEIKADVVAKDEREGGLRAI
LNLGHTFGHAIEAEQGYGNWLHGEAVAAGTIIACKAAEALTWFEASETRRVSSLFEAFAL
PVAGPNSMTKDDYVKHMKRDKKVEAGSIRFVLPQGIGKAVVTKDVTDAILTDILS