Protein Info for MIT1002_00436 in Alteromonas macleodii MIT1002

Annotation: Arginine N-succinyltransferase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF04958: AstA" amino acids 1 to 339 (339 residues), 485.7 bits, see alignment E=2.6e-150 TIGR03244: arginine N-succinyltransferase" amino acids 3 to 339 (337 residues), 480.2 bits, see alignment E=2.8e-148 TIGR03243: arginine and ornithine succinyltransferase subunits" amino acids 3 to 340 (338 residues), 470.5 bits, see alignment E=2.5e-145

Best Hits

Swiss-Prot: 53% identical to ASTG_PSEAE: Arginine N-succinyltransferase subunit beta (aruG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00673, arginine N-succinyltransferase [EC: 2.3.1.109] (inferred from 97% identity to amc:MADE_00498)

MetaCyc: 53% identical to arginine succinyltransferase beta subunit (Pseudomonas aeruginosa)
Arginine N-succinyltransferase. [EC: 2.3.1.109]; 2.3.1.109 [EC: 2.3.1.109]

Predicted SEED Role

"Arginine N-succinyltransferase (EC 2.3.1.109)" in subsystem Arginine and Ornithine Degradation (EC 2.3.1.109)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.109

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>MIT1002_00436 Arginine N-succinyltransferase subunit beta (Alteromonas macleodii MIT1002)
MNIIRPITKADYNALKEIAVESGIGFTSLPVNDELLQRKIDRAETAFNKPNVTEPGDESY
LFVMEDTTTGQVVGTTGIEAAVGIDDAFYHYHLSKVVHASRELNIHNTVDILTFCNDYTG
VTEICTLFLREQARGGINGRFLSKVRFLFMMEHRERFSETVIAEMRGVSDEEGRSPFWEW
LETHFFSMDFPTADYLTGIGNKVFIAELMPKYPIYVNLLSKEAQEVIGEVHDKTRPALQL
LEEEGFSCRGYVDIFDAGPTVEANLSHIRTAQSSLKLPVVIDDSAAAQGQTHYIINTSVS
DFRAVATEMTVSEEKQVAVLSRQAAAALNVKEGEHVRFAPVTFRD