Protein Info for MIT1002_00404 in Alteromonas macleodii MIT1002

Annotation: Formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01842: ACT
  • amino acids 6 to 57 (52 residues), 32.6 bits, 5.5e-12
• TIGR00655: formyltetrahydrofolate deformylase
  • amino acids 6 to 283 (278 residues), 344 bits, E=3.9e-107
• PF00551: Formyl_trans_N
  • amino acids 89 to 262 (174 residues), 130.8 bits, E=5.1e-42

Best Hits

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 93% identity to alt:ambt_16445)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

• formaldehyde oxidation VII (THF pathway) (4/4 steps found)
• folate transformations I (9/13 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Protein Sequence (284 amino acids)

>MIT1002_00404 Formyltetrahydrofolate deformylase (Alteromonas macleodii MIT1002)
MQQTFRLVIDCPDQIGLVASVSQFLADHNATIVEASHHTDLQTGRFFMRHEISTDSLKLD
HQSFVKEFAPLANEYQMNWKLSDSSKKQRVALLASLESHCLVDLLHRWHTGELHCDIPVI
IGNHPQMKQFADWYKVPFHWVDFKALGKEAAFAQITTLLQEYKIDLTVLARFMQILPDTL
CQELQGKAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTKDLDEGPIIEQSVKRI
SHSDSAADMVRKGKDCEVTALAHGVRYHLEDRVIIHRNKTVVFA