Protein Info for MIT1002_00396 in Alteromonas macleodii MIT1002

Annotation: potassium/proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 243 to 258 (16 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 14 to 385 (372 residues), 116.6 bits, see alignment E=1.3e-37 PF02254: TrkA_N" amino acids 400 to 500 (101 residues), 34.4 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: None (inferred from 95% identity to amc:MADE_00461)

Predicted SEED Role

"Sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>MIT1002_00396 potassium/proton antiporter (Alteromonas macleodii MIT1002)
MSDPLLSLVAVGLLSITCQYLAYKVRLPAILPLLIVGILVGPVFGVLNADDLFGDLLFPV
VSLSVAIILFEGSLTLKFSDIAGHGNMVRNLCSVGVVVTWLVAATAAHYSLDLTWQLSFL
FGAIVTVTGPTVIVPMLRTVRPKTNLANILRWEGIVIDPIGALLAVLVFEFIVASQETAI
THTLIAFGKTIGIGSVLGLASGYLLGLSIRKDWIPHYLLNTAVLTVILGVFAASNYVALE
SGLLAVTISGMVLANMKDVDVEDILEFKETLSVLLISGLFILLATRLNLQSVVDVGWGSI
VVLAAIMFVARPLSVLASSVGTGLKLNELALLSWIAPRGIVAAAVSALFSLKLEEIGYEG
AGIIVPIVFMVIIATVVVQSLTSRTVASLLKVRAPAPTGYLIFGGSKFNRALATEMINQK
LDVTIADTNWDAIREARMKDIPVYFGNPMSDHAARHLDLNTFGTVLIMSPYKQLNPLIAY
HFEYTMGKDKVWALTNNEQSTRPSHQVSEQYAKKLTLFDEGVTYGYLASAIARDSMVKTT
RLSDEFTYEQYIKQYGERATPLIAINAEGKSYTFINGNSIQPKAGWRVISLIEPERKEEK
VEVQK