Protein Info for MIT1002_00337 in Alteromonas macleodii MIT1002

Annotation: Inner membrane transport protein YbaT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 280 to 304 (25 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details PF13520: AA_permease_2" amino acids 13 to 398 (386 residues), 93.3 bits, see alignment E=2.4e-30 PF03222: Trp_Tyr_perm" amino acids 14 to 275 (262 residues), 24.6 bits, see alignment E=2e-09 PF00324: AA_permease" amino acids 18 to 363 (346 residues), 58.8 bits, see alignment E=6.4e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to amc:MADE_00403)

Predicted SEED Role

"Amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>MIT1002_00337 Inner membrane transport protein YbaT (Alteromonas macleodii MIT1002)
MNEHEHSNRKDSLSLWGAVSMGTGVMIGAGIFALTGQIAELAGTWFPFAFLVAAIIAGFS
SYSYIKMAQKYPSAGGIAMFLKKAYGRGLLTGACALLMFFSMVINESLVARTFGTYVLQL
FDSQGAEWLIPALGVSLLIVAFIVNILSNQFIQTLSFIMAFIKIAGLAVLAIGGLWATGL
SFESVSAQPQDTSATGFLGAVALGILGYKGFTTITNSGGELKQPEKNVGRAIVISISICV
VLYVFVAVAVGANLSIGEIIQAKDYSLAEASRPAFGQYGAWFTIAFAIIATSSGVVASIF
AVSRMLSMLTSMQLVPHRHFSLPGDIRRHSLIYTLVIAIFLTIFFDLSRIASIGVVFYIV
MDIFIHWGVFKHLRDDVQAKAWVLVSAIILDIIVLLSFMWVKAKSDIFIVGISVAGLLIV
FAAEKWFLKLHAYDDDDKNYN